Protein coding transcript 177310

• Transcript: Ll_transcript_44815
• CDS coordinates: 218-934 (+)
• Peptide sequence: MRFRACKVYSSCLWATSKLFFTSSSVVVPNPIRPFLGSTIPQAQGYKNSFLESRIYMSASTASLAKDEKVQGEGIGSLNSVEDQHGGVIVNMEEPMDSLDFASLLEASLSQWKEQGKKGVWIKLPIEHSNLVASAVKVGFRYHHAEPDYLMLVYWIPDTPDTLPANASHRVGIGAFVMNTNREVLVVQESNGRFSGTGIWKLPTGAVNEGEDICTAAIREVKEETGIDTEFVEVLAFR*
• ORF Type: complete

Annotations of Ll_transcript_44815

• Blastp: Nudix hydrolase 2 from Arabidopsis with 62.64% of identity
• Blastx: Nudix hydrolase 2 from Arabidopsis with 62.64% of identity
• Eggnog: NUDiX hydrolase(ENOG4111WDN)
• Kegg: Link to kegg annotations (AT5G47650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459774.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;