Protein coding transcript 17736

• Transcript: Ll_transcript_355736
• CDS coordinates: 2-445 (+)
• Peptide sequence: EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKVTYVYFSMKPRFKLEYNIYALSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_355736

• Blastp: ADP-ribosylation factor 1 from Arabidopsis with 98.4% of identity
• Blastx: ADP-ribosylation factor 1 from Arabidopsis with 99.19% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (AT2G47170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419533.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;