Protein coding transcript 177368

• Transcript: Ll_transcript_43064
• CDS coordinates: 1260-2018 (+)
• Peptide sequence: MQQNNYIEAEGAYLHALSIAPDNNKMCNLGICLMKQGRISEAKETLYRVKKPVVNDGPKGSDSHLKAYERAQQMLEDLESDMMNKGFDRIEQSKIFEAFLGSSSIWQPQPCKDHTNSTSSAKAANSFKTRDEFADENVNSNTISNRAAQHNNNKVAAMLGNSLNVAAPPFHACNENQSLEKLKRTRRVSSKEDSEKDKLIELLPDNKDFEDAILGALLCTPNSSSNTTIFKTKTNKRLKVFQDITLSMSPRA*
• ORF Type: complete

Annotations of Ll_transcript_43064

• Blastp: Protein POLLENLESS 3-LIKE 2 from Arabidopsis with 50.18% of identity
• Blastx: Protein POLLENLESS 3-LIKE 2 from Arabidopsis with 82.68% of identity
• Eggnog: Tetratricopeptide repeat(ENOG410YH00)
• Kegg: Link to kegg annotations (AT3G51280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420855.1)
• Pfam: Tetratricopeptide repeat (PF14559.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;