Protein coding transcript 177407

• Transcript: Ll_transcript_43046
• CDS coordinates: 127-1011 (+)
• Peptide sequence: MHSSKPPRRKVVPANGEDSGDKLEQLLLSSVICNNEDLGPFIRKAFISGKPETLHHHLRHFARTKESEIEEVCKEHYQDFIVAVDDLRSLLSDVDSLKSSLSDSNSKLQSVAIPLLSSLDAFVETRNVSKNVNLAIESVNTCIRLTEVCSRANRHLSSDNFYMALKCVDAIEREYLHKTPSSTLKRMLEKKIPEIRSHIERKVNKEFGDWLVEIRVVSRNLGQLAIGQASAARQREEDLRIKQRQAEEQSRLSLRDCIYALEEEDDDGIVAGGGGIGEDGYGGNNGGGGGGSGGG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_43046

• Blastp: Exocyst complex component SEC15B from Arabidopsis with 75.56% of identity
• Blastx: Exocyst complex component SEC15B from Arabidopsis with 75.76% of identity
• Eggnog: Exocyst complex component(ENOG410XQAE)
• Kegg: Link to kegg annotations (AT4G02350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440748.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;