Transcript | Ll_transcript_43046 |
---|---|
CDS coordinates | 127-1011 (+) |
Peptide sequence | MHSSKPPRRKVVPANGEDSGDKLEQLLLSSVICNNEDLGPFIRKAFISGKPETLHHHLRHFARTKESEIEEVCKEHYQDFIVAVDDLRSLLSDVDSLKSSLSDSNSKLQSVAIPLLSSLDAFVETRNVSKNVNLAIESVNTCIRLTEVCSRANRHLSSDNFYMALKCVDAIEREYLHKTPSSTLKRMLEKKIPEIRSHIERKVNKEFGDWLVEIRVVSRNLGQLAIGQASAARQREEDLRIKQRQAEEQSRLSLRDCIYALEEEDDDGIVAGGGGIGEDGYGGNNGGGGGGSGGG |
ORF Type | 3prime_partial |
Blastp | Exocyst complex component SEC15B from Arabidopsis with 75.56% of identity |
---|---|
Blastx | Exocyst complex component SEC15B from Arabidopsis with 75.76% of identity |
Eggnog | Exocyst complex component(ENOG410XQAE) |
Kegg | Link to kegg annotations (AT4G02350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440748.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer