Protein coding transcript 177420

• Transcript: Ll_transcript_43930
• CDS coordinates: 1298-1744 (+)
• Peptide sequence: MARIFWQLLLLPWRLMFAFIPPCHIAHGWISFIFSLVFISGIAYIVTKITDLISCVTGINAYVIAFTALASGTSWPDLVASKIAAERQTTADSAIANITCRARRAEALGVGYLHLLHVAVGHFCCTIFTQSFRNHLEFGERTTGFLIF*
• ORF Type: complete

Annotations of Ll_transcript_43930

• Blastp: Magnesium/proton exchanger from Arabidopsis with 70.16% of identity
• Blastx: Magnesium/proton exchanger from Arabidopsis with 69.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441333.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;