Transcript | Ll_transcript_43676 |
---|---|
CDS coordinates | 360-1376 (+) |
Peptide sequence | MESDPQQNNSPSGLTRYKSAPSSYFTNIIDKDFYQHIFNHPSSPETEQIFSRFMNSIGGDNDNDVTPAAAEEDSLPHNFSPVKEEIIINQQVNYEPVVWKEQQKQHCDINSNYSSTVHGFYQSSARPPLPNQNLNSGMDGTYSVGGVNRLQQMKTGSRNNLIRHSSSPAGLFSQINIENVYAGIRNKGSGSSNTMEEAKFCNARKVNNQPNYSSGSMAAIAEIEDKGNRENNEDIEGFAESHGNDFIQGFSAGTWDDSQIMPNNVTALKRHRNDEVKPFGGLNATETQEREGQSSLAHQLSMPNTSSEMAAIEKFLQFSDSVPCKIRAKRGCATHPRSI |
ORF Type | 3prime_partial |
Blastp | Transcription factor bHLH122 from Arabidopsis with 32.35% of identity |
---|---|
Blastx | Transcription factor bHLH122 from Arabidopsis with 32.35% of identity |
Eggnog | Transcription factor(ENOG410YDYN) |
Kegg | Link to kegg annotations (AT1G51140) |
CantataDB | Link to cantataDB annotations (CNT0002364) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448297.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer