Protein coding transcript 177452

• Transcript: Ll_transcript_43694
• CDS coordinates: 326-1477 (+)
• Peptide sequence: MSVMYSHVFKYSEEEQKRNQEMDYSIGNPQQNYHSQYNSELLRYLAENNTESCVKEEEAFISEENEIEQCYLPTTSSEMDTMLSNLISSNNGWNNSQPLHEFGDKTVKQEAGGEFISEQNGYSFGGSQTQLVYQSQQSEMGARNCSNLIRQKSSPPEFFANEKGLEALREVGSFRVSNVANGQTTASTSGLHSNLAFSPKPSSCLNRMPQIDENENERLEANCDRSRNLVNDNGSSEFYMPSFSNGFWEDSEFNAQKTAIEEDEIMFSASNALESQDAEFCYQNLGLTNNLSLPSSFSKMASAEKFLQTQGSIPCKTRAKRGFATHPRSIAERVRRTRISERIKKLQGLFPLSDKQTSTSDMLDMAFDYIKDLQDQVQVLEKF*
• ORF Type: complete

Annotations of Ll_transcript_43694

• Blastp: Transcription factor bHLH130 from Arabidopsis with 39.84% of identity
• Blastx: Transcription factor bHLH130 from Arabidopsis with 39.84% of identity
• Eggnog: Transcription factor(ENOG410YDYN)
• Kegg: Link to kegg annotations (AT2G42280)
• CantataDB: Link to cantataDB annotations (CNT0002364)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443607.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;