Protein coding transcript 177518

• Transcript: Ll_transcript_44143
• CDS coordinates: 201-659 (+)
• Peptide sequence: MDETAVKSKPDCINKRTKASRECTGDVGRGGGDEDSDDEECDGEAWNTLSLNFRQAQSVLDQNRVLIEEVNKNHESKIPDNMAKNVDLIQKINSNISKVLSIYSNLSSSFSNSVRQQRGFAPATAKRKNRDGDGDGNDEDDDKVEDVPEPVS*
• ORF Type: complete

Annotations of Ll_transcript_44143

• Blastp: Protein EARLY FLOWERING 4 from Arabidopsis with 60% of identity
• Blastx: Protein EARLY FLOWERING 4 from Arabidopsis with 62.75% of identity
• Eggnog: early flowering(ENOG410Y56Z)
• Kegg: Link to kegg annotations (AT2G40080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460518.1)
• Pfam: Protein of unknown function (DUF1313) (PF07011.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;