Protein coding transcript 177587

• Transcript: Ll_transcript_43507
• CDS coordinates: 193-609 (+)
• Peptide sequence: MVIENSSKGYEGKRESDTTNSEKLSMAPSTTSTSSRQWAAFRNPRIVRVSRALGGKDRHSKVCTIRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVIDWLIEASKLDIDKLPPLQIPHGFPQNLILISSLHFKSLMV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_43507

• Blastp: Transcription factor TCP5 from Arabidopsis with 83.33% of identity
• Blastx: Transcription factor TCP5 from Arabidopsis with 83.33% of identity
• Eggnog: Transcription factor(ENOG410YQU0)
• Kegg: Link to kegg annotations (AT5G60970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438945.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;