Protein coding transcript 177604

• Transcript: Ll_transcript_44168
• CDS coordinates: 696-1289 (+)
• Peptide sequence: MPTSSSSTVDCLSNGSELEDVEKVKMKHENIMSIGDDASDGALWDIFRRQDVPKLQEYLKKHFREFRHVHCRPLNQVIHPIHDQTMYLTEEHKKKLKEEYGIEPWTFIQKLGDAVFIPTGCPHQVRNLKSCIKVALDFVSPENVGECFRLAEEFRTLPINHKSSEDKLEVKKIIVHAMDNVVKNLYNTRYGQTKVSR*
• ORF Type: complete

Annotations of Ll_transcript_44168

• Blastp: Lysine-specific demethylase JMJ25 from Arabidopsis with 69.13% of identity
• Blastx: Lysine-specific demethylase JMJ25 from Arabidopsis with 53.65% of identity
• Eggnog: lysine (K)-specific demethylase(ENOG410XTAA)
• Kegg: Link to kegg annotations (AT3G07610)
• CantataDB: Link to cantataDB annotations (CNT0001036)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427795.1)
• Pfam: JmjC domain, hydroxylase (PF02373.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;