Protein coding transcript 177623

• Transcript: Ll_transcript_43463
• CDS coordinates: 161-883 (+)
• Peptide sequence: MDTDQITVQPPHDRGAGGKVRRPPLRKPPATPYARPPDTTRRRWISKLVDPAYRLIAGGASRILPSFFSTPAPAPALTGTSSDSEDDQGKWESGEQGHGDDGPKSYSHLQESKSTEMESAGHISGKLKSSSVINLHRQNEKGEQSDKNRISDIEKLVEGNTFSRDEFNRLVEVLNSRAIDVPNVEKGKESNNLASRKDHQELAFAHRLPKVSNERRHEELNGAIWGNSIPLGPSKVSVVT*
• ORF Type: complete

Annotations of Ll_transcript_43463

• Blastp: Nuclear pore complex protein NUP1 from Arabidopsis with 29.71% of identity
• Blastx: Nuclear pore complex protein NUP1 from Arabidopsis with 28.98% of identity
• Eggnog: nuclear pore complex protein(ENOG410XPV4)
• Kegg: Link to kegg annotations (AT3G10650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415343.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;