Transcript | Ll_transcript_43491 |
---|---|
CDS coordinates | 134-535 (+) |
Peptide sequence | MSNSSSKSRPPSSQPSETTTSSKRKRGVFQKELQHMMYGFGDDVNPLPESVALMEDIVVEYVTDLVHKAQDIGSQRGKLSVDDFLYLIRKDSRKLNRCTELLSMNEELKQARKVFESDEDKLRKVFEVDETAE* |
ORF Type | complete |
Blastp | Transcription initiation factor TFIID subunit 13 from Arabidopsis with 72.07% of identity |
---|---|
Blastx | Transcription initiation factor TFIID subunit 13 from Arabidopsis with 76% of identity |
Eggnog | TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor(COG5248) |
Kegg | Link to kegg annotations (AT1G02680) |
CantataDB | Link to cantataDB annotations (CNT0002486) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426677.1) |
Pfam | Transcription initiation factor IID, 18kD subunit (PF02269.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer