Protein coding transcript 177638

• Transcript: Ll_transcript_43496
• CDS coordinates: 182-589 (+)
• Peptide sequence: MNSSSASTSSKPRAASSQPSETSSKRKRGVFQKELQHMMYGFGDDVNPLPESVALMEDIVVEYVTDLVHKAQDIGSQRGKLSVDDFLYLIRKDSRKLNRCTELLSMNEELKQARKVFESDEDKLRKVFEVDETAE*
• ORF Type: complete

Annotations of Ll_transcript_43496

• Blastp: Transcription initiation factor TFIID subunit 13 from Arabidopsis with 72.73% of identity
• Blastx: Transcription initiation factor TFIID subunit 13 from Arabidopsis with 73.83% of identity
• Eggnog: TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor(COG5248)
• Kegg: Link to kegg annotations (AT1G02680)
• CantataDB: Link to cantataDB annotations (CNT0002486)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426677.1)
• Pfam: Transcription initiation factor IID, 18kD subunit (PF02269.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;