Protein coding transcript 17770

• Transcript: Ll_transcript_356055
• CDS coordinates: 50-475 (+)
• Peptide sequence: MLDLNLNNTLHFESSLSFNSSSSILNPTDTDDSSSNTTNAFPYTFPILNSVAHSHTPTIQLFPLPEPPCSVTASQRIITSQPQQKQVVKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGEDPTPMKMMIILS*
• ORF Type: complete

Annotations of Ll_transcript_356055

• Blastp: AP2-like ethylene-responsive transcription factor TOE2 from Arabidopsis with 95.35% of identity
• Blastx: AP2-like ethylene-responsive transcription factor SMZ from Arabidopsis with 100% of identity
• Eggnog: AP2(ENOG4110426)
• Kegg: Link to kegg annotations (AT5G60120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442390.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;