Protein coding transcript 177731

• Transcript: Ll_transcript_44940
• CDS coordinates: 944-1273 (+)
• Peptide sequence: MTPSGEEENVNNVKPDNLPMKMLYKFLLVGSVKSGTSTIFKQGKLLYNVPFSESEHQDIKLVIQTNLFTYIAILLEERGNFEEEILLENRKRQHVNESTSSGNCFSLVK*
• ORF Type: complete

Annotations of Ll_transcript_44940

• Blastp: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 53.01% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 51.67% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT2G23460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448536.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;