Protein coding transcript 177742

• Transcript: Ll_transcript_44851
• CDS coordinates: 238-705 (+)
• Peptide sequence: MLMPYLLRYSRMETAIQFYIGSIEGRVGVHHLDDSQQGKNFTFKCHRENNEIYSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMQRCSQPIPCSTFNNDGSIYAYAVCYDWSKGAENHNPATAKNYIYLHLPQESDVKGKPRTGAMGRK*
• ORF Type: complete

Annotations of Ll_transcript_44851

• Blastp: Protein RAE1 from Arabidopsis with 86.23% of identity
• Blastx: Protein RAE1 from Arabidopsis with 86.23% of identity
• Eggnog: RAE1 RNA export 1 homolog (S. pombe)(ENOG410XQ1M)
• Kegg: Link to kegg annotations (AT1G80670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443338.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;