Protein coding transcript 177858

• Transcript: Ll_transcript_42508
• CDS coordinates: 3131-3442 (-)
• Peptide sequence: MLEPLLHAQIQIQLVTGMKSIMHALNVKRWYSTNHILSDGRQIIIGVTKQFNYEYYPKTPSQSKTYSLPFLNETFDPYGGTIFTPMFLWTWIGTFYSTTKVEL*
• ORF Type: complete

Annotations of Ll_transcript_42508

• Blastp: Aldehyde oxidase GLOX1 from Arabidopsis with 37.31% of identity
• Blastx: Aldehyde oxidase GLOX1 from Arabidopsis with 35.69% of identity
• Eggnog: Glyoxal oxidase(ENOG41110V0)
• Kegg: Link to kegg annotations (AT1G67290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015960738.1)
• Pfam: Glyoxal oxidase N-terminus (PF07250.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;