Protein coding transcript 177860

• Transcript: Ll_transcript_42512
• CDS coordinates: 283-726 (+)
• Peptide sequence: MVKAEFLHHVGVNYLFAPWISWFLLLQSAPFLAPKTTVYLTLWWVFAIPVVLLDLKIYGQWFTKGKRFLSTVANPTSQLSVIGNLVGAQAAAHMGWKESAVCMFSLGMVHYLVLFVTLYQRLSGGKGLPVMLRPVFFLFFAAPSVASL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_42512

• Blastp: S-type anion channel SLAH1 from Arabidopsis with 68.03% of identity
• Blastx: S-type anion channel SLAH1 from Arabidopsis with 62.84% of identity
• Eggnog: S-type anion channel SLAH1-like(ENOG410YDIV)
• Kegg: Link to kegg annotations (AT1G62280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438040.1)
• Pfam: Voltage-dependent anion channel (PF03595.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;