Transcript | Ll_transcript_44345 |
---|---|
CDS coordinates | 1929-2723 (+) |
Peptide sequence | MADNPMNTIFVPSKRPIQQTLIETVGITKVGVYIETSSGFGQSNNSIHCHHGLLSAEIGQLSTIPPKQRSREAVKAFIKNKKDIPIEAFKGGFILSKVANPWSTGELKLKNTNVDDNPNVTFNYFNHPYDVQRCVEGIRLATKVVQSQHFTNYTMFDRQTTQELLNLTVKANVNFIPKNLNDTKSLEQFCRDTVITIWHYHGGCHVGKVINNDYKVIGVDRLSVVDGSTFTESPGTNPQATVMMLGRYMGLKILRDRLGKLAGV* |
ORF Type | complete |
Blastp | Protein HOTHEAD from Arabidopsis with 66.29% of identity |
---|---|
Blastx | Protein HOTHEAD from Arabidopsis with 66.17% of identity |
Eggnog | oxidoreductase(COG2303) |
Kegg | Link to kegg annotations (AT1G72970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448219.1) |
Pfam | GMC oxidoreductase (PF05199.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer