Protein coding transcript 177886

• Transcript: Ll_transcript_44349
• CDS coordinates: 573-1565 (+)
• Peptide sequence: MGVIFKDENGKQHEAMLGSDRHSEVIVSSGAIGTPQLLLLSGIGPKPELENLNISVVLDNKFIGKGMADNPMNTIFVPSKRPIQQTLIETVGITKLGVYIETSCGFGQSNNSIHCHHGLLSAEIGQLSTIPPKQRSREAVEAFIKNKKDIPIEAFKGGFILSKVANPWSTGELKLINTNVEDNPAVTFNYFNHPYDVQRCVEGIRLATKVVQSQHFTNYTMCDRQSTEELLNLTVKANVNLIPKHLNDTKSLEQFCKDTVITIWHYHGGCHVGKVINNDYKVLGVDRLSVVDGSTFTESPGTNPQATVMMLGRYMGVKILRERLGKLAGI*
• ORF Type: complete

Annotations of Ll_transcript_44349

• Blastp: Protein HOTHEAD from Arabidopsis with 67.48% of identity
• Blastx: Protein HOTHEAD from Arabidopsis with 68.11% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (AT1G72970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436496.1)
• Pfam: GMC oxidoreductase (PF00732.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;