Transcript | Ll_transcript_44349 |
---|---|
CDS coordinates | 573-1565 (+) |
Peptide sequence | MGVIFKDENGKQHEAMLGSDRHSEVIVSSGAIGTPQLLLLSGIGPKPELENLNISVVLDNKFIGKGMADNPMNTIFVPSKRPIQQTLIETVGITKLGVYIETSCGFGQSNNSIHCHHGLLSAEIGQLSTIPPKQRSREAVEAFIKNKKDIPIEAFKGGFILSKVANPWSTGELKLINTNVEDNPAVTFNYFNHPYDVQRCVEGIRLATKVVQSQHFTNYTMCDRQSTEELLNLTVKANVNLIPKHLNDTKSLEQFCKDTVITIWHYHGGCHVGKVINNDYKVLGVDRLSVVDGSTFTESPGTNPQATVMMLGRYMGVKILRERLGKLAGI* |
ORF Type | complete |
Blastp | Protein HOTHEAD from Arabidopsis with 67.48% of identity |
---|---|
Blastx | Protein HOTHEAD from Arabidopsis with 68.11% of identity |
Eggnog | oxidoreductase(COG2303) |
Kegg | Link to kegg annotations (AT1G72970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436496.1) |
Pfam | GMC oxidoreductase (PF00732.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer