Protein coding transcript 177888

• Transcript: Ll_transcript_44353
• CDS coordinates: 315-938 (+)
• Peptide sequence: MINQIGQLSTIPPKQRSKEAIQAFRDNKRDIPIEAFKGGFILSKVASAWSAGKLRLNNTSAEDNPIVTFNYFSHPYDLQRCVEGIRLATKVVQSQHLTNYTLSDRKTIEKLLNLSVKANVNLIPKHPNDTESLEQFCKDTVITIWHYHGGCHVGKVVSNDYKVLGVDKLRVVDGSTFTESPGANPQATVMMMGRYMGLKILRERLGK*
• ORF Type: complete

Annotations of Ll_transcript_44353

• Blastp: Protein HOTHEAD from Arabidopsis with 65.05% of identity
• Blastx: Protein HOTHEAD from Arabidopsis with 63.98% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (AT1G72970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424638.1)
• Pfam: GMC oxidoreductase (PF05199.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;