Protein coding transcript 177894

• Transcript: Ll_transcript_44329
• CDS coordinates: 2036-2830 (+)
• Peptide sequence: MADNPMNTIFVPSKRPIQQTLIETVGITKVGVYIETSSGFGQSNNSIHCHHGLLSAEIGQLSTIPPKQRSREAVKAFIKNKKDIPIEAFKGGFILSKVANPWSTGELKLKNTNVDDNPNVTFNYFNHPYDVQRCVEGIRLATKVVQSQHFTNYTMFDRQTTQELLNLTVKANVNFIPKNLNDTKSLEQFCRDTVITIWHYHGGCHVGKVINNDYKVIGVDRLSVVDGSTFTESPGTNPQATVMMLGRYMGLKILRDRLGKLAGV*
• ORF Type: complete

Annotations of Ll_transcript_44329

• Blastp: Protein HOTHEAD from Arabidopsis with 66.29% of identity
• Blastx: Protein HOTHEAD from Arabidopsis with 66.17% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (AT1G72970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448219.1)
• Pfam: GMC oxidoreductase (PF05199.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;