Transcript | Ll_transcript_43267 |
---|---|
CDS coordinates | 148-1290 (+) |
Peptide sequence | MASSETPSPSTPITSAPTAPFSYNNMPQNVINTSHHSSTYSVVQHPLPAMSSHPAPSFKFNIPQTGHAFSSNHHPQSNMNMSDSVAQDVNKVSSASSIPNSVPPHSSNPTRPTYDPNYRPPTSWMPSAPSFPMHHVIPGTPGNPAPPGLTPAPVISSNLSAPSISSDSSSAAVPRQNLPSAAIASDPTLQQKGTPYPSIPVMAASPQGHWLPPPQISGVLRPPFLPYPAAFPGPFPFPARGVTLPAVPVPDSQPPGVTPMSAAGATSASPASSHQLRGTTGFQTEAIPGHADYKKTLNVTQNENMRLDSNQVYLKTKLKSVFRMHIQVNTYFPEGKTIQHPKHLTIEFKIKAVTDCTGQFQNILRNAQISQFQSILRKAQI |
ORF Type | 3prime_partial |
Blastp | Pre-mRNA-processing protein 40C from Arabidopsis with 34.19% of identity |
---|---|
Blastx | - |
Eggnog | transcription elongation regulator(ENOG410XPZW) |
Kegg | Link to kegg annotations (AT3G19840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413264.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer