Protein coding transcript 177947

• Transcript: Ll_transcript_43150
• CDS coordinates: 3-530 (+)
• Peptide sequence: KFGKLIEAKVVVDKLSGRSRGFGFVTFGEKKAMEDAIDAMNGIDLDGRTITVDKAQPQQGSTRDDGDRFRDRDRGRDRGRDRDYGGGRGSNGGECFKCGKPGHFARECPSEGERGGRYGGRDSKYGGSSAGGRYGPDRNGDRSSGGRNRDAGSRGESGNDRYHRDRDRAGPYERR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_43150

• Blastp: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 51.35% of identity
• Blastx: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 70.91% of identity
• Eggnog: Zinc knuckle(ENOG411219Q)
• Kegg: Link to kegg annotations (AT3G26420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441025.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;