Protein coding transcript 177951

• Transcript: Ll_transcript_43153
• CDS coordinates: 615-1046 (+)
• Peptide sequence: MEEAIDAMNGVDLDGRTITVDKAQPQQGSSRDDGDRHRERGRDRGRDRDYGGGRGSNGGECFKCGKPGHFARECPSEGERGGRYGDRESRYGSRSGGPDRNADRSSVRRSRDGDSHGDSGNDRYDRDRDRSGPYERRGSGGNR*
• ORF Type: complete

Annotations of Ll_transcript_43153

• Blastp: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 54.01% of identity
• Blastx: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 62.24% of identity
• Eggnog: Zinc knuckle(ENOG411219Q)
• Kegg: Link to kegg annotations (AT3G26420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425499.1)
• Pfam: Zinc knuckle (PF13917.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;