Protein coding transcript 177954

• Transcript: Ll_transcript_43158
• CDS coordinates: 584-1006 (+)
• Peptide sequence: MEEAIDAMNGVDLDGRTITVDRAQPQQGSRDDGDRHRERGRDRGRDRDYGGGRGSNGGECFKCGKPGHFARECPSEGERGGRYGDRESRYGGRSGGPDRNADRSSGRRHRDADSHGDSGNDRYDRDRAGPYERRGSGGHR*
• ORF Type: complete

Annotations of Ll_transcript_43158

• Blastp: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 61.62% of identity
• Blastx: Glycine-rich RNA-binding protein RZ1A from Arabidopsis with 62.89% of identity
• Eggnog: Zinc knuckle(ENOG411219Q)
• Kegg: Link to kegg annotations (AT3G26420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419429.1)
• Pfam: Zinc knuckle (PF13917.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;