Protein coding transcript 177974

• Transcript: Ll_transcript_43189
• CDS coordinates: 124-789 (+)
• Peptide sequence: MASNMILVVSSLVLSALVSLILQLFYFSPIDPLPLHILPASSSTNNHLQNVIKLGEGDLKDPEDVCVDKEGTFYTATRDGWIKRLPRNGNWENWKHIHSSTLLGITTTKGGIIVCDAIKGLLKVTEDGVSILVSQVNGLQLSFADDVIEASDGSVYFSVASTKFDLHNWHLDMLEARPHGQLLKYNPTSNEIDIVLDNLAFANGVALSKDEDYIVICETWK*
• ORF Type: complete

Annotations of Ll_transcript_43189

• Blastp: Protein STRICTOSIDINE SYNTHASE-LIKE 5 from Arabidopsis with 33.33% of identity
• Blastx: Protein STRICTOSIDINE SYNTHASE-LIKE 5 from Arabidopsis with 33.5% of identity
• Eggnog: SMP-30 gluconolaconase LRE domain protein(COG3386)
• Kegg: Link to kegg annotations (AT3G51430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414226.1)
• Pfam: SMP-30/Gluconolaconase/LRE-like region (PF08450.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;