Transcript | Ll_transcript_356269 |
---|---|
CDS coordinates | 133-669 (+) |
Peptide sequence | MKGMMKFAGYSFPFSIPPITSILTLNTCRFSNSNLCRPIFFSAYTQKQSYRKSQSGVLAKCYLPPSFSVAPMMDWTDNHYRTLARIISKHAWLYTEMVAAETIVHQKENLDRFLAFSPDQHPIVLQIGGSNIESLAKATELSNAYCYDEINLKFVYFLSPYILSFIVPLISDRVFSLI* |
ORF Type | complete |
Blastp | tRNA-dihydrouridine(20/20a) synthase from Vibrio with 51.16% of identity |
---|---|
Blastx | tRNA-dihydrouridine(20/20a) synthase from Thermus with 47.83% of identity |
Eggnog | Catalyzes the synthesis of dihydrouridine a modified base found in the D-loop of most tRNAs (By similarity)(COG0042) |
Kegg | Link to kegg annotations (VP2727) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019412853.1) |
Pfam | Dihydrouridine synthase (Dus) (PF01207.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer