Protein coding transcript 17800

• Transcript: Ll_transcript_356270
• CDS coordinates: 133-669 (+)
• Peptide sequence: MKGMMKFAGYSFPFSIPPITSILTLNTCRFSNSNLCRPIFFSAYTQKQSYRKSQSGVLAKCYLPPSFSVAPMMDWTDNHYRTLARIISKHAWLYTEMVAAETIVHQKENLDRFLAFSPDQHPIVLQIGGSNIESLAKATELSNAYCYDEINLKFVYFLSPYILSFIVPLISDRVFSLI*
• ORF Type: complete

Annotations of Ll_transcript_356270

• Blastp: tRNA-dihydrouridine(20/20a) synthase from Vibrio with 51.16% of identity
• Blastx: tRNA-dihydrouridine(20/20a) synthase from Thermus with 47.83% of identity
• Eggnog: Catalyzes the synthesis of dihydrouridine a modified base found in the D-loop of most tRNAs (By similarity)(COG0042)
• Kegg: Link to kegg annotations (VP2727)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412853.1)
• Pfam: Dihydrouridine synthase (Dus) (PF01207.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;