Transcript | Ll_transcript_43365 |
---|---|
CDS coordinates | 1-447 (+) |
Peptide sequence | GGVVLHSSKWLRVDKESVSGFSSFSISSSFFFLIPILPHSHFYFYTRLYVRGTILGYKRSKSNQYPNTSLLQIEGVNTKEEVAWYAGKRLAYIYKAKVKTNGSHYRCIWGRVTRSHGNSGIVRAKFKSNLPPKSMGARVRVFLYPSNI* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L35a-2 from Arabidopsis with 87.25% of identity |
---|---|
Blastx | 60S ribosomal protein L35a-2 from Arabidopsis with 87.25% of identity |
Eggnog | Ribosomal protein(COG2451) |
Kegg | Link to kegg annotations (AT1G41880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455845.1) |
Pfam | Ribosomal protein L35Ae (PF01247.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer