Protein coding transcript 178061

• Transcript: Ll_transcript_43365
• CDS coordinates: 1-447 (+)
• Peptide sequence: GGVVLHSSKWLRVDKESVSGFSSFSISSSFFFLIPILPHSHFYFYTRLYVRGTILGYKRSKSNQYPNTSLLQIEGVNTKEEVAWYAGKRLAYIYKAKVKTNGSHYRCIWGRVTRSHGNSGIVRAKFKSNLPPKSMGARVRVFLYPSNI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_43365

• Blastp: 60S ribosomal protein L35a-2 from Arabidopsis with 87.25% of identity
• Blastx: 60S ribosomal protein L35a-2 from Arabidopsis with 87.25% of identity
• Eggnog: Ribosomal protein(COG2451)
• Kegg: Link to kegg annotations (AT1G41880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455845.1)
• Pfam: Ribosomal protein L35Ae (PF01247.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;