Protein coding transcript 178062

• Transcript: Ll_transcript_43366
• CDS coordinates: 3-365 (+)
• Peptide sequence: RRGFAFIKMVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLLQIEGVNTKEEVAWYAGKRLAYIYKAKVKTNGSHYRCIWGRVTRSHGNSGIVRAKFKSNLPPKSMGARVRVFLYPSNI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_43366

• Blastp: 60S ribosomal protein L35a-3 from Arabidopsis with 88.39% of identity
• Blastx: 60S ribosomal protein L35a-3 from Arabidopsis with 88.39% of identity
• Eggnog: Ribosomal protein(COG2451)
• Kegg: Link to kegg annotations (AT1G74270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455845.1)
• Pfam: Ribosomal protein L35Ae (PF01247.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;