Transcript | Ll_transcript_43370 |
---|---|
CDS coordinates | 117-413 (+) |
Peptide sequence | MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLLQIEGVNTKEEVTWYAGKRLAYIYKAKVKTNGSHYRCIWGRVTRSHGNSGIVRAKFKSNLPPKSM |
ORF Type | 3prime_partial |
Blastp | 60S ribosomal protein L35a-3 from Arabidopsis with 88.89% of identity |
---|---|
Blastx | 60S ribosomal protein L35a-3 from Arabidopsis with 88.89% of identity |
Eggnog | Ribosomal protein(COG2451) |
Kegg | Link to kegg annotations (AT1G74270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460881.1) |
Pfam | Ribosomal protein L35Ae (PF01247.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer