Protein coding transcript 178090

• Transcript: Ll_transcript_44419
• CDS coordinates: 665-1180 (+)
• Peptide sequence: MPDKGWAVRTLEKIPEGAPVCEYIGILKRSDEVENDIDNSYFFEIDCKQTINEIEGRERRLCHVPLPTSSPVDNETTETEPEFCIDAGSYGNVARFINHSCEPNLFVQCVLSGHHDIRLARVVLFAATDICPYQELTYDYGYQLDSVIGADGNIKQMLCHCGEPNCRRRLY*
• ORF Type: complete

Annotations of Ll_transcript_44419

• Blastp: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 from Arabidopsis with 65.09% of identity
• Blastx: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 from Arabidopsis with 63.51% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT5G13960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442833.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;