Protein coding transcript 178102

• Transcript: Ll_transcript_44440
• CDS coordinates: 104-616 (+)
• Peptide sequence: MVKFLKPNKAVILLQGRYAGKKAVIVRTFDDGTRDRPYGHCLVAGIKKYPSKVIKKDSAKKTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVNVDVLSGKDKKVTALKETKKRLEERFKTGKNSLMRLCCGCVGHVVVTFCDSVSHRNCCVMWLRRSLQPQYCGCIT*
• ORF Type: complete

Annotations of Ll_transcript_44440

• Blastp: 60S ribosomal protein L27 from Pisum with 92.86% of identity
• Blastx: 60S ribosomal protein L27 from Pisum with 92.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439334.1)
• Pfam: Ribosomal L27e protein family (PF01777.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;