Transcript | Ll_transcript_44584 |
---|---|
CDS coordinates | 143-985 (+) |
Peptide sequence | MLVLCGKSNTENEAAKAIKINNTIKLSQSGDFSVVLHSELDKTDMKHSFQVDSFMNSLSTNTFGRFLIWSPQLDTTHDVVSNNFSELPVGTVCVADVQTKGRGRSKNVWESPLGCLMFSFTLQMEDGRVVPLVQYVVSLAITEAVKDICDKNGLPFLDVKIKWPNDIYLNGFKVGGILCTSKYSSKKFNVSAGIGLNVNNEKPTTSLNSVLRELSVEGYQFRREDVLAAFFNKFEKFYELFINQGTLIIVPLNCFCYHLQHQVPILIIIILLRLCLSLSL* |
ORF Type | complete |
Blastp | Biotin--protein ligase 1, chloroplastic from Arabidopsis with 65.85% of identity |
---|---|
Blastx | Biotin--protein ligase 1, chloroplastic from Arabidopsis with 65.23% of identity |
Eggnog | Biotin- acetyl-CoA-carboxylase ligase(COG0340) |
Kegg | Link to kegg annotations (AT2G25710) |
CantataDB | Link to cantataDB annotations (CNT0002087) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433158.1) |
Pfam | Biotin/lipoate A/B protein ligase family (PF03099.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer