| Transcript | Ll_transcript_45055 |
|---|---|
| CDS coordinates | 124-591 (+) |
| Peptide sequence | MLIFAVAKRTSVFDDPTMEIQELTGVIKQDINALNSAVLDLQSLSNSRNQSGDFSADTTTHSTTVVDDLKTRLMSTTKEFKDVLTMRTENLKVHENRRQLFSSSASKESANPFVRQRPLATRTSASSSNAQAPPWANASGSPSSSQLFPKLDWLN* |
| ORF Type | complete |
| Blastp | Syntaxin-32 from Arabidopsis with 71.43% of identity |
|---|---|
| Blastx | Syntaxin-32 from Arabidopsis with 65.99% of identity |
| Eggnog | Syntaxin 5(ENOG410Y2MB) |
| Kegg | Link to kegg annotations (AT3G24350) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415743.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer