Protein coding transcript 178249

• Transcript: Ll_transcript_45045
• CDS coordinates: 1841-2209 (+)
• Peptide sequence: MAIHRKQEDGESQPLLQQQQQQQEIVPVQDSYMQSRAEALHNVESTIHELSNIFNQLATLVSQQGEVAIRIDENMDDTLANVEGAQGALLKYLNGISSNRWLMIKIFFVLIFFLMVFLFFVA*
• ORF Type: complete

Annotations of Ll_transcript_45045

• Blastp: Syntaxin-32 from Arabidopsis with 75.41% of identity
• Blastx: Syntaxin-32 from Arabidopsis with 62.45% of identity
• Eggnog: Syntaxin 5(ENOG410Y2MB)
• Kegg: Link to kegg annotations (AT3G24350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415743.1)
• Pfam: Syntaxin (PF00804.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;