Protein coding transcript 178259

• Transcript: Ll_transcript_44472
• CDS coordinates: 169-837 (+)
• Peptide sequence: MEESLLLLGFKEENEDTNSSTSLRLVPWLNWNEWIFVKHALFSNSTSSIASALNRISAWRSRGSLPITVQITASIIEIQLKDPYFQMVDHASDSDEILSMLYCMAITRLVNGVIEKTRVKELVSIAVAAEAIGIPRTLIDIRHEASHRELPSLKVVRTASIKALDWLKFYYWEPQSKAIPFQGERNDKVKKEVKSKIRELAICVKVKGNPQPSTSLLKGKRV*
• ORF Type: complete

Annotations of Ll_transcript_44472

• Blastp: Ribosomal biogenesis protein LAS1L from Homo with 36% of identity
• Blastx: Ribosomal biogenesis protein LAS1L from Homo with 36% of identity
• Eggnog: LAS1-like (S. cerevisiae)(ENOG411230Q)
• Kegg: Link to kegg annotations (81887)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460433.1)
• Pfam: Las1-like (PF04031.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;