Transcript | Ll_transcript_44472 |
---|---|
CDS coordinates | 169-837 (+) |
Peptide sequence | MEESLLLLGFKEENEDTNSSTSLRLVPWLNWNEWIFVKHALFSNSTSSIASALNRISAWRSRGSLPITVQITASIIEIQLKDPYFQMVDHASDSDEILSMLYCMAITRLVNGVIEKTRVKELVSIAVAAEAIGIPRTLIDIRHEASHRELPSLKVVRTASIKALDWLKFYYWEPQSKAIPFQGERNDKVKKEVKSKIRELAICVKVKGNPQPSTSLLKGKRV* |
ORF Type | complete |
Blastp | Ribosomal biogenesis protein LAS1L from Homo with 36% of identity |
---|---|
Blastx | Ribosomal biogenesis protein LAS1L from Homo with 36% of identity |
Eggnog | LAS1-like (S. cerevisiae)(ENOG411230Q) |
Kegg | Link to kegg annotations (81887) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460433.1) |
Pfam | Las1-like (PF04031.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer