| Transcript | Ll_transcript_389638 |
|---|---|
| CDS coordinates | 2-325 (+) |
| Peptide sequence | RLFTTTSLRPHSLSGHLFNSKTIGLRGLATANMVKDPFKPAARVAGRRQDVWSIVNEAAQASPVQPIVNMGQGFFGYNPPQFVLDAAHEALGRVECNQYSPTKGRPRL |
| ORF Type | internal |
| Blastp | Uncharacterized aminotransferase C6B12.04c from Schizosaccharomyces with 54.29% of identity |
|---|---|
| Blastx | Uncharacterized aminotransferase C6B12.04c from Schizosaccharomyces with 54.29% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC6B12.04c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003601073.2) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer