Protein coding transcript 178311

• Transcript: Ll_transcript_44788
• CDS coordinates: 2-415 (+)
• Peptide sequence: TVLQRMDPFINQILFTAAHVSFYDFNLQTNQWSRKDVEGSLFVVKRSSQPRFQFIVMNRRNTDNLVENLLDFEYELKKPYLLYRNAAQDVNGIWFYDPDECEQVANLFNRYINFSLIKFFMLCTYVFPSFLCSISFS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_44788

• Blastp: mRNA-decapping enzyme-like protein from Arabidopsis with 77.19% of identity
• Blastx: mRNA-decapping enzyme-like protein from Arabidopsis with 77.19% of identity
• Eggnog: DCP1 decapping enzyme homolog b (S. cerevisiae)(ENOG410XRY6)
• Kegg: Link to kegg annotations (AT1G08370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432900.1)
• Pfam: Dcp1-like decapping family (PF06058.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;