Transcript | Ll_transcript_44790 |
---|---|
CDS coordinates | 192-1025 (+) |
Peptide sequence | MSQQSKKLTPNLDEQSTKVLNLTVLQRMDSFIDQILFTAAHVSFYDFNLQTNQWSRKDVEGSLFVVKRNSQPRFQFIVMNRRNTDNLVENLLDFEYELKKPYLLYRNAAQDVNGIWFYDPDECEQVANLFNRILGAYPKVPPTTTIPSNNSVFEELEPVSIITKSPLHLSSSSNDAHEDPIFTNFFSTSIETINSGKEVNNLLKPSTYFSSTSSSSYPMLQPFPPPNPSLSLAPISNSNPSKPVITRDKVRDALVSLFQDDQFIDMMFQALLKVNHS* |
ORF Type | complete |
Blastp | mRNA-decapping enzyme-like protein from Arabidopsis with 63.78% of identity |
---|---|
Blastx | mRNA-decapping enzyme-like protein from Arabidopsis with 63.78% of identity |
Eggnog | DCP1 decapping enzyme homolog b (S. cerevisiae)(ENOG410XRY6) |
Kegg | Link to kegg annotations (AT1G08370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432900.1) |
Pfam | Dcp1-like decapping family (PF06058.12) |
Rfam | tRNA (RF00005) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer