Protein coding transcript 178367

• Transcript: Ll_transcript_42812
• CDS coordinates: 48-458 (+)
• Peptide sequence: MAKHVIDNEYLKEIDKARRDLRALISTTNCAPLMLRLAWHDAGTYDAKTRTGGPNGSIRNVEELNHTANKGLQKAVEFCEEVKTKHPILSYADLYQLAGVVAVEVTGGPTIDFIPGRKDLLESPPEGRLPDAKQGN*
• ORF Type: complete

Annotations of Ll_transcript_42812

• Blastp: L-ascorbate peroxidase 3 from Arabidopsis with 71.85% of identity
• Blastx: L-ascorbate peroxidase 3 from Arabidopsis with 71.85% of identity
• Eggnog: Bifunctional enzyme with both catalase and broad- spectrum peroxidase activity (By similarity)(COG0376)
• Kegg: Link to kegg annotations (AT4G35000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423695.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;