Protein coding transcript 178368

• Transcript: Ll_transcript_42813
• CDS coordinates: 57-359 (+)
• Peptide sequence: MAKLAVDNDYLKEIDKARRHLRALISTRNCAPLMLRLAWHDAGTYDDKTRTGGPNGSIRNTQELNHSANKGLQKAVEFCGDHSSSFVCVCLYLFFSLPNS*
• ORF Type: complete

Annotations of Ll_transcript_42813

• Blastp: L-ascorbate peroxidase 5, peroxisomal from Arabidopsis with 74.32% of identity
• Blastx: L-ascorbate peroxidase 5, peroxisomal from Arabidopsis with 74.32% of identity
• Eggnog: Bifunctional enzyme with both catalase and broad- spectrum peroxidase activity (By similarity)(COG0376)
• Kegg: Link to kegg annotations (AT4G35970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444830.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;