Protein coding transcript 178490

• Transcript: Ll_transcript_273756
• CDS coordinates: 420-800 (+)
• Peptide sequence: MQQGGGSETEVTWEDQQNINNFGRLNNRLHELEDEIKFAKETNDNLEDASNELIITDEEVVRFQIGEVFAHVPKDEVEDRIEQMKEVTSQKLEKFEEEKESVLGQMSELKKILYGKFKDSINLEED*
• ORF Type: complete

Annotations of Ll_transcript_273756

• Blastp: Probable prefoldin subunit 4 from Arabidopsis with 71.32% of identity
• Blastx: Probable prefoldin subunit 4 from Arabidopsis with 71.32% of identity
• Eggnog: Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding (By similarity)(COG1382)
• Kegg: Link to kegg annotations (AT1G08780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004495612.1)
• Pfam: Prefoldin subunit (PF01920.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;