Transcript | Ll_transcript_273760 |
---|---|
CDS coordinates | 145-525 (+) |
Peptide sequence | MQQGGGSETEVTWEDQQNINKFGRLNNRFHELEDEIKFAKESNDNLEDASNELIITDEEVVRFQIGEVFAHVSKDEVENRIEEMKEATSQKLEKLEEEKESVLAQMSELKKILYGKFKDSINLEEE* |
ORF Type | complete |
Blastp | Probable prefoldin subunit 4 from Arabidopsis with 72.09% of identity |
---|---|
Blastx | Probable prefoldin subunit 4 from Avena with 76.23% of identity |
Eggnog | Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding (By similarity)(COG1382) |
Kegg | Link to kegg annotations (AT1G08780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439941.1) |
Pfam | Prefoldin subunit (PF01920.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer