| Transcript | Ll_transcript_355629 |
|---|---|
| CDS coordinates | 59-391 (+) |
| Peptide sequence | MNTFSSSSSTLLGSSALPSLKITSPFSKCHTTRLVTKASVAVEQQTQHPKVALIRIGTRGRYSFFSCFWVIPIYLFLTKVCIFLVLLCWVCFEELLLYKIVLPLFFSSLM* |
| ORF Type | complete |
| Blastp | Porphobilinogen deaminase, chloroplastic from Pisum with 66.67% of identity |
|---|---|
| Blastx | Porphobilinogen deaminase, chloroplastic from Pisum with 92.37% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421975.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer