Protein coding transcript 178626

• Transcript: Ll_transcript_274823
• CDS coordinates: 122-739 (+)
• Peptide sequence: MVDGILSSGSKQSYELPSQKELIQQTFAGDDVEDDFEKDKQEILNRENPEPEKPVSLPGWGQWTHIQQKKGEPSWMLKEHENAQRKRAEALKRRKDAQLKNVIISEKLDKKAEKLHTKSLPFPFTSKEMFEQSMRVPIGPEFNPATAIGPLNRPEVVKRPGVIIKPIEFEEVNPHEQRSEDKHKLKRSKGEGSKSVKKMKVDRKR*
• ORF Type: complete

Annotations of Ll_transcript_274823

• Blastp: U3 small nucleolar RNA-associated protein 14 homolog C from Homo with 39.62% of identity
• Blastx: U3 small nucleolar RNA-associated protein 14 homolog C from Homo with 39.62% of identity
• Eggnog: Small nucleolar(COG5644)
• Kegg: Link to kegg annotations (9724)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418839.1)
• Pfam: Utp14 protein (PF04615.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;