Transcript | Ll_transcript_273377 |
---|---|
CDS coordinates | 243-1232 (+) |
Peptide sequence | MRRQISTNPPLPPPAHPSQPSPIAAAIWRACAGPSVQIPTVNSMVYYFIQGHLDQASTPKKLSPNVYSTPFVLARIAQVQFFADHNTDEVFVKLVLHPINRSSVSQFVVGESSNGSGDGDENDVVSFSKILTPSDANNGGGFSVPRFCADSIFPPLNFQEDPPFQNLMMFDLHGNVWDYRHIYRGTPRRHLLTTGWSKFVNFKNLVAGDSVVFMKNSKGEIFAGIRRAKRSCPRGGGGGSGAEWHGMMLGGGGMRKRDEEGEKKKQEEKVVKEGFSRNGKGKLAPEKVAEAAELAVQGMPFEVVYYPSAGWSDFVLKAEIVDEAIKVRWS |
ORF Type | 3prime_partial |
Blastp | Auxin response factor 17 from Arabidopsis with 50.81% of identity |
---|---|
Blastx | Auxin response factor 17 from Arabidopsis with 50.49% of identity |
Eggnog | auxin response factor(ENOG410ZJKK) |
Kegg | Link to kegg annotations (AT1G77850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438562.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer