Protein coding transcript 178692

• Transcript: Ll_transcript_273377
• CDS coordinates: 243-1232 (+)
• Peptide sequence: MRRQISTNPPLPPPAHPSQPSPIAAAIWRACAGPSVQIPTVNSMVYYFIQGHLDQASTPKKLSPNVYSTPFVLARIAQVQFFADHNTDEVFVKLVLHPINRSSVSQFVVGESSNGSGDGDENDVVSFSKILTPSDANNGGGFSVPRFCADSIFPPLNFQEDPPFQNLMMFDLHGNVWDYRHIYRGTPRRHLLTTGWSKFVNFKNLVAGDSVVFMKNSKGEIFAGIRRAKRSCPRGGGGGSGAEWHGMMLGGGGMRKRDEEGEKKKQEEKVVKEGFSRNGKGKLAPEKVAEAAELAVQGMPFEVVYYPSAGWSDFVLKAEIVDEAIKVRWS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_273377

• Blastp: Auxin response factor 17 from Arabidopsis with 50.81% of identity
• Blastx: Auxin response factor 17 from Arabidopsis with 50.49% of identity
• Eggnog: auxin response factor(ENOG410ZJKK)
• Kegg: Link to kegg annotations (AT1G77850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438562.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;