Protein coding transcript 1787

• Transcript: Ll_transcript_389575
• CDS coordinates: 103-498 (+)
• Peptide sequence: MANMLITLTTLITLLSFFSTPSCGRVLVGGKMEISEVKKNMQVQELGKFAVEEYNKGITKLRLNGGEGEEGLKFVEVVKAQYQVVAGVKYYLEISAMENGVHKVFNSVVVVKPWLHSKNLLNFGPLSTSFE*
• ORF Type: complete

Annotations of Ll_transcript_389575

• Blastp: Cysteine proteinase inhibitor 10 from Oryza sativa with 45.3% of identity
• Blastx: Cysteine proteinase inhibitor 2 from Arabidopsis with 41.28% of identity
• Eggnog: Cysteine proteinase inhibitor(ENOG410YYG2)
• Kegg: Link to kegg annotations (4335551)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416780.1)
• Pfam: Cystatin domain (PF00031.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;