Protein coding transcript 178720

• Transcript: Ll_transcript_273949
• CDS coordinates: 1072-1836 (+)
• Peptide sequence: MDLFYISNYILRIFQLGTSFKFHLQDSIDLGQNDRPSFGTLDFTSSIVRGRFSVDSDVGPERANVPIRTSIGDGSRVSVSSIGYASSVASGPDDFESLGDVYIWGKVWTDGISSDGLGSQVPSKIDVLAPKALESNVVIDVYQIASGVRHIALVTRQGEVFTWGEESGGRLGHGSDKDFCQPHLVESLAMTSVSFVSCGEFHTCAVSTSGDLYTWGDGTHNVGLLGHGTNVSHWIPKRVSGPLEGLKVVSLACGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_273949

• Blastp: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 61.17% of identity
• Blastx: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 61.17% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (AT1G76950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431959.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;